PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G267300.1
Common NamePOPTR_0001s27430g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 328aa    MW: 37021.4 Da    PI: 6.183
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G267300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.8e-162572148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Potri.001G267300.1 25 KGLWSPEEDEKLIKYMLTNGQGCWSEIARNAGLQRCGKSCRLRWINYL 72
                        678*******************************************97 PP

2Myb_DNA-binding52.51.1e-1678122147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++ 
  Potri.001G267300.1  78 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 122
                         89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6542072IPR017930Myb domain
SuperFamilySSF466891.02E-2823119IPR009057Homeodomain-like
SMARTSM007175.0E-132474IPR001005SANT/Myb domain
PfamPF002491.2E-142572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-242679IPR009057Homeodomain-like
CDDcd001677.78E-112872No hitNo description
PROSITE profilePS5129424.88773127IPR017930Myb domain
SMARTSM007171.8E-1677125IPR001005SANT/Myb domain
PfamPF002492.7E-1578122IPR001005SANT/Myb domain
CDDcd001672.42E-1180123No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2680126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MRKPDLMARD RVPINNNMNR AKLRKGLWSP EEDEKLIKYM LTNGQGCWSE IARNAGLQRC  60
GKSCRLRWIN YLRPDLKRGA FSPQEEELII HLHSILGNRW SQIAARLPGR TDNEIKNFWN  120
STLKKRFKIN STSTSSPNDS SDSSEPRDHV VGNIMPMHDH DVMTLCKDSS SSPSISMHGV  180
VTGNQFDPFT VLSNRYDVSG AASLFDMSTC LTQVGMGDGF YGDHYGILEG NNKIGLESDL  240
SLPPLESRSI EENNAVSNNR IGVKSSSNDN HHFDSTCFNN TDQRFKVEDM LGLENHWQGE  300
NVRMGEWDLE GLMENISSFP FLDFQVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27231275108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486750.0KF148675.1 Populus trichocarpa MYB transcription factor (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299944.20.0hypothetical protein POPTR_0001s27430g
TrEMBLB9GFE80.0B9GFE8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s27430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.15e-89myb domain protein 83
Publications ? help Back to Top
  1. Zhao Y,Sun J,Xu P,Zhang R,Li L
    Intron-mediated alternative splicing of WOOD-ASSOCIATED NAC TRANSCRIPTION FACTOR1B regulates cell wall thickening during fiber development in Populus species.
    Plant Physiol., 2014. 164(2): p. 765-76
    [PMID:24394777]